[ Download FASTA ]
Name Example sequence
Description P. falc. ABC transporter PROTEIN PF14_0321 aa18-257
Type AMINO
Length 249
Molecular Weight 29312
Sequence
MAHHHHHHMQRTRIKALQNVNLCFERGMRILVCGKNGAGKSTLLSIIAGKKLIKENEVLIFNKQAFHDTDISNKIGYVG
EWWSEEYAMNISIKDFCFNYEYTKRYKNLLKLFELDENKIISNLSKGERKKVQIMVNIIVRKDIYIFDEATESLDLVSR
KLLLEFLKKECIKYNSIVIYSTHIFDHMDKWSTHVLYLSEGIVTFFSNIYNITNLENYSSLAEYICDHMVEEIKKKENV
DKLDDLLLIDSD
Hydavg -0.27
Dismax 13
DisEMBL Version 1.50
Disorder
Dismax
[ Recalculate Disorder ]
13
DisEMBL Version 1.50 last calculated on 2018-07-11T11:43:11 from DisEMBL
HTML output from DisEMBL

Disordered by Loops/coils definition

>none_LOOPS 1-9, 33-40, 62-80, 117-129, 208-217, 233-249
MAHHHHHHMq rtrikalqnv nlcfergmri lvCGKNGAGK stllsiiagk klikenevli fNKQAFHDTD ISNKIGYVGE wwseeyamni sikdfcfnye ytkryknllk lfeldeNKII SNLSKGERKk vqimvniivr kdiyifdeat esldlvsrkl lleflkkeci kynsiviyst hifdhmdkws thvlylsegi vtffsniYNI TNLENYSsla eyicdhmvee ikKKENVDKL DDLLLIDSD

Disordered by Hot-loops definition

>none_HOTLOOPS 1-13, 62-73, 119-133, 232-249
MAHHHHHHMQ RTRikalqnv nlcfergmri lvcgkngagk stllsiiagk klikenevli fNKQAFHDTD ISNkigyvge wwseeyamni sikdfcfnye ytkryknllk lfeldenkII SNLSKGERKK VQImvniivr kdiyifdeat esldlvsrkl lleflkkeci kynsiviyst hifdhmdkws thvlylsegi vtffsniyni tnlenyssla eyicdhmvee iKKKENVDKL DDLLLIDSD

Disordered by Remark-465 definition

>none_REM465 1-13
MAHHHHHHMQ RTRikalqnv nlcfergmri lvcgkngagk stllsiiagk klikenevli fnkqafhdtd isnkigyvge wwseeyamni sikdfcfnye ytkryknllk lfeldenkii snlskgerkk vqimvniivr kdiyifdeat esldlvsrkl lleflkkeci kynsiviyst hifdhmdkws thvlylsegi vtffsniyni tnlenyssla eyicdhmvee ikkkenvdkl ddlllidsd